General Information

  • ID:  hor004649
  • Uniprot ID:  G7JV15
  • Protein name:  CLE13p
  • Gene name:  CLE13
  • Organism:  Medicago truncatula (Barrel medic) (Medicago tribuloides)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE13p]: Induced in roots during nodulation triggered by low nitrogen and infection with Sinorhizobium meliloti . |[CLE13p]: Expressed in young nodules throughout the central tissue .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Medicago (genus), Trifolieae (tribe), IRL clade, Hologalegina, NPAAA clade, 50 kb inversion clade, Papilionoideae (subfamily), Fabaceae (family), Fabales (order), fabids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0030154 cell differentiation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DRLSPAGPDPQHNG
  • Length:  14
  • Propeptide:  MGRYTTDQVQVYVLVIVLCTFFSTLQARSLRDHPLIHKNIDSRSLLQKLRIHISNHKQVRDISGDRLSPAGPDPQHNGRSPPRK
  • Signal peptide:  MGRYTTDQVQVYVLVIVLCTFFSTLQARS
  • Modification:  T5 Hydroxyproline;T8 Hydroxyproline
  • Glycosylation:  T8 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Signaling peptide involved in the regulation of nodulation.
  • Mechanism:  Moves from root to shoot to function with the receptor kinase SUNN, in a signaling pathway that plays roles during cellular differentiation, both at the onset of nodulation, and later during nodule meristem development and subsequent homeostasis. Interacts with SUNN signaling to control nodule numbers. SUNN is involved in the autoregulation of nodulation (AON), a long distance systemic signaling from root to shoot and back again, which allows legumes to limit the number of root nodules formed based on available nitrogen and previous rhizobial colonization (Probable).
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-G7JV15-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004649_AF2.pdbhor004649_ESM.pdb

Physical Information

Mass: 169259 Formula: C60H93N21O22
Absent amino acids: CEFIKMTVWY Common amino acids: P
pI: 5.41 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -160.71 Boman Index: -4399
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 35
Instability Index: 6359.29 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA